
Esm
- 21 installs
- Updated June 29, 2026
- eturkes/claude-scientific-skills
Helps with ai & agent building tasks.
About
esm is a Claude Code skill for ai & agent building. It helps solo builders move faster with AI-assisted coding.
- esm
- AI & Agent Building
- AI-coding skill
Esm by the numbers
- 21 all-time installs (skills.sh)
- Ranked #10,307 of 16,546 AI & Agent Building skills by installs in the Skillselion catalog
- Data as of Jul 24, 2026 (Skillselion catalog sync)
npx skills add https://github.com/eturkes/claude-scientific-skills --skill esmAdd your badge
Show developers this skill is listed on Skillselion. Paste this into your README.
| Installs | 21 |
|---|---|
| Last updated | June 29, 2026 |
| Repository | eturkes/claude-scientific-skills ↗ |
What it does
Helps with ai & agent building tasks.
Files
ESM: Evolutionary Scale Modeling
Overview
ESM provides protein language models for understanding, generating, and designing proteins. Use this skill for current EvolutionaryScale/Biohub workflows: ESM3 for generative design, ESMC for representation learning and embeddings, hosted Forge/Biohub inference, and ESMFold2 all-atom structure prediction.
Core Capabilities
1. Protein Sequence Generation with ESM3
Generate novel protein sequences with desired properties using multimodal generative modeling.
When to use:
- Designing proteins with specific functional properties
- Completing partial protein sequences
- Generating variants of existing proteins
- Creating proteins with desired structural characteristics
Basic usage:
from esm.models.esm3 import ESM3
from esm.sdk.api import ESM3InferenceClient, ESMProtein, GenerationConfig
# Load local open weights after accepting the license on Hugging Face.
model: ESM3InferenceClient = ESM3.from_pretrained("esm3-open").to("cuda")
# Create protein prompt
protein = ESMProtein(sequence="MPRT___KEND") # '_' represents masked positions
# Generate completion
protein = model.generate(protein, GenerationConfig(track="sequence", num_steps=8))
print(protein.sequence)For remote/cloud usage via Forge API:
import os
import esm
from esm.sdk.api import ESMProtein, GenerationConfig
# Same interface as local ESM3; token from ESM_API_KEY (see Authentication)
model = esm.sdk.client("esm3-medium-2024-08", token=os.environ["ESM_API_KEY"])
# Generate
protein = model.generate(protein, GenerationConfig(track="sequence", num_steps=8))See references/esm3-api.md for detailed ESM3 model specifications, advanced generation configurations, and multimodal prompting examples.
2. Structure Prediction and Inverse Folding
Use ESM3's structure track for structure prediction from sequence or inverse folding (sequence design from structure).
Structure prediction:
from esm.sdk.api import ESM3InferenceClient, ESMProtein, GenerationConfig
# Predict structure from sequence
protein = ESMProtein(sequence="MPRTKEINDAGLIVHSP...")
protein_with_structure = model.generate(
protein,
GenerationConfig(track="structure", num_steps=protein.sequence.count("_"))
)
# Access predicted structure
coordinates = protein_with_structure.coordinates # 3D coordinates
pdb_string = protein_with_structure.to_pdb()Inverse folding (sequence from structure):
# Design sequence for a target structure
protein_with_structure = ESMProtein.from_pdb("target_structure.pdb")
protein_with_structure.sequence = None # Remove sequence
# Generate sequence that folds to this structure
designed_protein = model.generate(
protein_with_structure,
GenerationConfig(track="sequence", num_steps=50, temperature=0.7)
)3. Protein Embeddings with ESM C
Generate high-quality embeddings for downstream tasks like function prediction, classification, or similarity analysis.
When to use:
- Extracting protein representations for machine learning
- Computing sequence similarities
- Feature extraction for protein classification
- Transfer learning for protein-related tasks
Basic usage:
from esm.models.esmc import ESMC
from esm.sdk.api import ESMProtein, LogitsConfig
# Load ESM C model
model = ESMC.from_pretrained("esmc_300m").to("cuda")
# Get embeddings
protein = ESMProtein(sequence="MPRTKEINDAGLIVHSP...")
protein_tensor = model.encode(protein)
logits_output = model.logits(
protein_tensor,
LogitsConfig(sequence=True, return_embeddings=True),
)
embeddings = logits_output.embeddingsBatch processing:
# Encode multiple proteins
proteins = [
ESMProtein(sequence="MPRTKEIND..."),
ESMProtein(sequence="AGLIVHSPQ..."),
ESMProtein(sequence="KTEFLNDGR...")
]
embeddings_list = [
model.logits(
model.encode(p),
LogitsConfig(sequence=True, return_embeddings=True),
).embeddings
for p in proteins
]See references/esm-c-api.md for ESM C model details, efficiency comparisons, and advanced embedding strategies.
4. Function Conditioning and Annotation
Use ESM3's function track to generate proteins with specific functional annotations or predict function from sequence.
Function-conditioned generation:
from esm.sdk.api import ESMProtein, FunctionAnnotation, GenerationConfig
# Create protein with desired function
protein = ESMProtein(
sequence="_" * 200, # Generate 200 residue protein
function_annotations=[
FunctionAnnotation(label="fluorescent_protein", start=50, end=150)
]
)
# Generate sequence with specified function
functional_protein = model.generate(
protein,
GenerationConfig(track="sequence", num_steps=200)
)5. Chain-of-Thought Generation
Iteratively refine protein designs using ESM3's chain-of-thought generation approach.
from esm.sdk.api import GenerationConfig
# Multi-step refinement
protein = ESMProtein(sequence="MPRT" + "_" * 100 + "KEND")
# Step 1: Generate initial structure
config = GenerationConfig(track="structure", num_steps=50)
protein = model.generate(protein, config)
# Step 2: Refine sequence based on structure
config = GenerationConfig(track="sequence", num_steps=50, temperature=0.5)
protein = model.generate(protein, config)
# Step 3: Predict function
config = GenerationConfig(track="function", num_steps=20)
protein = model.generate(protein, config)6. Batch Processing with Forge API
Process multiple proteins efficiently using Forge's async methods.
import os
import asyncio
import esm
from esm.sdk.api import ESMProtein, GenerationConfig
client = esm.sdk.client("esm3-medium-2024-08", token=os.environ["ESM_API_KEY"])
# Async batch processing
async def batch_generate(proteins_list):
tasks = [
client.async_generate(protein, GenerationConfig(track="sequence"))
for protein in proteins_list
]
return await asyncio.gather(*tasks)
# Execute
proteins = [ESMProtein(sequence=f"MPRT{'_' * 50}KEND") for _ in range(10)]
results = asyncio.run(batch_generate(proteins))See references/forge-api.md for detailed Forge API documentation, authentication, rate limits, and batch processing patterns.
Model Selection Guide
ESM3 Models (Generative):
esm3-open(1.4B) - Open weights, local usage after accepting the Hugging Face licenseesm3-medium-2024-08(7B) - Best balance of quality and speed (Forge only)esm3-large-2024-03(98B) - Highest quality, slower (Forge only)
ESM C Models (Embeddings):
esmc_300m/esmc-300m-2024-12(30 layers) - Lightweight, fast inference (open weights, local)esmc_600m/esmc-600m-2024-12(36 layers) - Balanced performance (open weights, local)esmc-6b-2024-12(80 layers) - Maximum quality (Forge API; local 6B weights require Forge or SageMaker)
Local ESMC.from_pretrained() examples use underscore aliases (esmc_300m, esmc_600m). Hosted API clients use dated model IDs such as esmc-600m-2024-12.
Selection criteria:
- Local development/testing: Use
esm3-openoresmc_300m - Production quality: Use
esm3-medium-2024-08via Forge - Maximum accuracy: Use
esm3-large-2024-03oresmc-6b-2024-12via Forge - High throughput: Use Forge or Biohub APIs with explicit async concurrency limits
- Cost optimization: Use smaller models, implement caching strategies
Installation
Install from PyPI (`esm` on PyPI by EvolutionaryScale). Current PyPI release: 3.2.3 (Oct 14, 2025). Requires Python >=3.12,<3.13.
Basic installation:
uv pip install "esm==3.2.3"With Flash Attention (recommended for faster inference on NVIDIA GPUs):
uv pip install "esm==3.2.3"
uv pip install flash-attn --no-build-isolationThe Forge client ships with the esm package - no extra install for ESM3 or ESMC Forge inference.
Authentication
Forge API access requires an API key. Never hardcode tokens in scripts or commit them to version control.
1. Check whether ESM_API_KEY is already set in the environment. 2. If not, check a local .env for ESM_API_KEY only (do not load unrelated secrets). 3. If still missing, create a key in the Biohub developer console for Biohub APIs or Forge for legacy Forge-hosted ESM3/ESMC access.
import os
token = os.environ["ESM_API_KEY"] # raises KeyError if unsetesm.sdk.client() reads ESM_API_KEY automatically when token is omitted. Keep endpoint URLs fixed to trusted hosts such as https://forge.evolutionaryscale.ai or https://biohub.ai; do not take API hosts from untrusted user input.
Biohub platform: EvolutionaryScale and Forge now surface current hosted models through biohub.ai. SDK class names may still reference "Forge". See references/biohub-platform.md for ESMFold2 and Biohub-specific setup.
Common Workflows
For detailed examples and complete workflows, see references/workflows.md which includes:
- Novel GFP design with chain-of-thought
- Protein variant generation and screening
- Structure-based sequence optimization
- Function prediction pipelines
- Embedding-based clustering and analysis
References
This skill includes comprehensive reference documentation:
references/esm3-api.md- ESM3 model architecture, API reference, generation parameters, and multimodal promptingreferences/esm-c-api.md- ESM C model details, embedding strategies, and performance optimizationreferences/forge-api.md- Forge platform documentation, authentication, batch processing, and deploymentreferences/biohub-platform.md- Biohub API migration, ESMFold2 structure prediction, and developer-console authreferences/workflows.md- Complete examples and common workflow patterns
These references contain detailed API specifications, parameter descriptions, and advanced usage patterns. Load them as needed for specific tasks.
Best Practices
For generation tasks:
- Start with smaller models for prototyping (
esm3-open) - Use temperature parameter to control diversity (0.0 = deterministic, 1.0 = diverse)
- Implement iterative refinement with chain-of-thought for complex designs
- Validate generated sequences with structure prediction or wet-lab experiments
For embedding tasks:
- Batch process sequences when possible for efficiency
- Cache embeddings for repeated analyses
- Normalize embeddings when computing similarities
- Use appropriate model size based on downstream task requirements
For production deployment:
- Use Forge API for scalability and latest models
- Implement error handling and retry logic for API calls
- Monitor token usage and implement rate limiting
- Consider AWS SageMaker deployment for dedicated infrastructure
Resources and Documentation
- GitHub Repository: https://github.com/Biohub/esm (current ESMC/ESMFold2/Biohub docs; ESM3 docs remain linked from the repository)
- Forge Platform: https://forge.evolutionaryscale.ai
- Biohub Platform: https://biohub.ai
- Scientific Paper: Hayes et al., Science (2025) - https://www.science.org/doi/10.1126/science.ads0018
- Blog Posts:
- ESM3 Release: https://www.evolutionaryscale.ai/blog/esm3-release
- ESM C Launch: https://www.evolutionaryscale.ai/blog/esm-cambrian
- Community: Slack community at https://bit.ly/3FKwcWd
- Model Weights: Hugging Face EvolutionaryScale and Biohub organizations
Responsible Use
ESM is designed for beneficial applications in protein engineering, drug discovery, and scientific research. Follow the Responsible Biodesign Framework (https://responsiblebiodesign.ai/) and Biohub Acceptable Use Policy (https://biohub.org/acceptable-use-policy/) when designing novel proteins. Consider biosafety and ethical implications of protein designs before experimental validation.
Biohub Platform and ESMFold2
Overview
EvolutionaryScale and Forge now surface current hosted ESM workflows through the Biohub platform. The Python SDK still uses esm.sdk.forge client classes and "Forge" naming in some places, but current Biohub APIs use https://biohub.ai endpoints.
Use this reference when you need all-atom structure prediction (ESMFold2) or when upstream docs point to biohub.ai instead of forge.evolutionaryscale.ai.
Authentication
Create API keys in the Biohub developer console. Store the key in ESM_API_KEY (same env var used by esm.sdk.client() on Forge).
import os
token = os.environ["ESM_API_KEY"]Never commit API keys or paste them into notebooks checked into git.
Installation
For ESM3/ESMC workflows on PyPI, uv pip install "esm==3.2.3" remains the standard reproducible path.
For ESMFold2 and the newest Biohub SDK features, upstream may recommend installing from the Biohub GitHub repo. Avoid floating branch installs in automated or production instructions. Pin a trusted release or a full 40-character commit SHA from the official Biohub repository, and review the verified GitHub release/commit before installing:
uv pip install "esm@git+https://github.com/Biohub/esm.git@<full-40-character-commit-sha>"Confirm which install source your task requires before mixing PyPI and GitHub builds in one environment.
ESMFold2 Structure Prediction
ESMFold2 is a structure prediction model built on ESMC 6B, available through SequenceStructureForgeInferenceClient with Biohub as the API host. Biohub lists ESMFold2 as a 2026-04/2026-05 model family and documents esmfold2-fast-2026-05 for hosted inference.
import os
from esm.sdk.forge import SequenceStructureForgeInferenceClient
from esm.sdk.api import FoldingConfig
from esm.utils.structure.input_builder import ProteinInput, StructurePredictionInput
client = SequenceStructureForgeInferenceClient(
model="esmfold2-fast-2026-05",
url="https://biohub.ai",
token=os.environ["ESM_API_KEY"],
)
sequence = "MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK"
fold_input = StructurePredictionInput(
sequences=[ProteinInput(id="A", sequence=sequence)]
)
config = FoldingConfig(num_loops=3, num_sampling_steps=32)
result = client.fold_all_atom(fold_input, config=config)
with open("result.cif", "w") as f:
f.write(result.complex.to_mmcif())Hosted ESMC Embeddings
Biohub also documents hosted ESMC inference with esmc_client() and dated ESMC model IDs:
import os
from esm.sdk import esmc_client
from esm.sdk.api import ESMProtein, LogitsConfig
model = esmc_client(
model="esmc-600m-2024-12",
url="https://biohub.ai",
token=os.environ["ESM_API_KEY"],
)
protein = ESMProtein(sequence="MPRTKEINDAGLIVHSPQWFYK")
protein_tensor = model.encode(protein)
logits_output = model.logits(
protein_tensor,
LogitsConfig(sequence=True, return_embeddings=True),
)
embeddings = logits_output.embeddingsModel IDs
| Model ID | Use case |
|---|---|
esmfold2-fast-2026-05 | Fast single-sequence folding |
| Check Biohub docs for additional variants | MSA-augmented or higher-accuracy modes |
ESMFold2 predicts static all-atom structures. Treat outputs as hypotheses that require experimental validation, especially for therapeutic, clinical, or safety-sensitive uses.
Relationship to Forge (ESM3 / ESM C)
| Capability | Typical endpoint | Client |
|---|---|---|
| ESM3 generation | https://forge.evolutionaryscale.ai | esm.sdk.client() or ESM3ForgeInferenceClient |
| ESM C 6B embeddings (hosted) | Forge | ESM3ForgeInferenceClient with esmc-6b-2024-12 |
| ESMC hosted embeddings | https://biohub.ai | esmc_client() with dated ESMC model IDs |
| ESMFold2 structure prediction | https://biohub.ai | SequenceStructureForgeInferenceClient |
For ESM3 and ESM C cloud usage patterns, see forge-api.md. For local open-weight models, see esm3-api.md and esm-c-api.md.
Additional Resources
- Biohub: https://biohub.ai
- Biohub/esm repository: https://github.com/Biohub/esm
- Tutorials: https://github.com/Biohub/esm/tree/main/cookbook/tutorials
- ESMC & ESMFold2 preprint: https://biohub.ai/papers/esm_protein.pdf
ESM C API Reference
Overview
ESM C (Cambrian) is a family of protein language models optimized for representation learning and efficient embedding generation. Designed as a drop-in replacement for ESM2, ESM C provides significant improvements in speed and quality across all model sizes.
Model Architecture
ESM C Family Models:
| Model ID | Parameters | Layers | Best For |
|---|---|---|---|
esmc_300m / esmc-300m-2024-12 | 300M | 30 | Fast inference, lightweight applications |
esmc_600m / esmc-600m-2024-12 | 600M | 36 | Balanced performance and quality |
esmc-6b-2024-12 | 6B | 80 | Maximum quality (Forge API; not open weights) |
Key Features:
- 3x faster inference than ESM2
- Improved perplexity and embedding quality
- Efficient architecture for production deployment
- Compatible with ESM2 workflows (drop-in replacement)
- Support for long sequences (up to 1024 residues efficiently)
Architecture Improvements over ESM2:
- Optimized attention mechanisms
- Better token representation
- Enhanced training procedures
- Reduced memory footprint
Core API Components
ESMC Class
Main interface for ESM C models.
Model Loading:
from esm.models.esmc import ESMC
from esm.sdk.api import ESMProtein, LogitsConfig
# Load model with automatic device placement
model = ESMC.from_pretrained("esmc_300m").to("cuda")
# Or specify device explicitly
model = ESMC.from_pretrained("esmc_600m").to("cpu")
# For maximum local quality (open weights: esmc_300m or esmc_600m)
# For 6B hosted inference, use Forge with esmc-6b-2024-12 (see forge-api.md)
model = ESMC.from_pretrained("esmc_600m").to("cuda")Model Selection Criteria:
- esmc_300m: Development, real-time applications, batch processing of many sequences
- esmc_600m: Production deployments, good quality/speed balance
- esmc-6b-2024-12 (Forge): Research, maximum accuracy when 6B open weights are unavailable locally
Basic Embedding Generation
Single Sequence:
from esm.models.esmc import ESMC
from esm.sdk.api import ESMProtein, LogitsConfig
# Load model
model = ESMC.from_pretrained("esmc_600m").to("cuda")
# Create protein
protein = ESMProtein(sequence="MPRTKEINDAGLIVHSPQWFYK")
# Encode to tensor
protein_tensor = model.encode(protein)
# Generate logits and embeddings
logits_output = model.logits(
protein_tensor,
LogitsConfig(sequence=True, return_embeddings=True),
)
embeddings = logits_output.embeddings
logits = logits_output.logits
print(f"Embedding shape: {embeddings.shape}")
print(f"Logits shape: {logits.shape}")Output Shapes:
For a sequence of length L:
embeddings.shape:(1, L, hidden_dim)where hidden_dim depends on model- esmc_300m: hidden_dim = 960
- esmc_600m: hidden_dim = 1152
- esmc-6b: hidden_dim = 2560
logits.shape:(1, L, 64)- per-position amino acid predictions
Batch Processing
Process multiple sequences efficiently:
import torch
# Multiple proteins
sequences = [
"MPRTKEINDAGLIVHSP",
"AGKWFYLTQSNHERVPM",
"DEIFKRNAVWGSLTPQY"
]
proteins = [ESMProtein(sequence=seq) for seq in sequences]
# Encode all
protein_tensors = [model.encode(p) for p in proteins]
# Process batch (if same length)
# For variable lengths, process individually or pad
embeddings_list = []
for tensor in protein_tensors:
embedding = model.forward(tensor)
embeddings_list.append(embedding)
print(f"Processed {len(embeddings_list)} proteins")Efficient Batching for Variable Lengths:
def batch_encode_variable_length(model, sequences, max_batch_size=32):
"""
Efficiently batch encode sequences of variable length.
Groups by similar length for efficiency.
"""
# Sort by length
sorted_seqs = sorted(enumerate(sequences), key=lambda x: len(x[1]))
results = [None] * len(sequences)
batch = []
batch_indices = []
for idx, seq in sorted_seqs:
batch.append(seq)
batch_indices.append(idx)
# Process batch when full or length changes significantly
if (len(batch) >= max_batch_size or
(len(batch) > 0 and abs(len(seq) - len(batch[0])) > 10)):
# Process current batch
proteins = [ESMProtein(sequence=s) for s in batch]
embeddings = [model.forward(model.encode(p)) for p in proteins]
# Store results
for i, emb in zip(batch_indices, embeddings):
results[i] = emb
batch = []
batch_indices = []
# Process remaining
if batch:
proteins = [ESMProtein(sequence=s) for s in batch]
embeddings = [model.forward(model.encode(p)) for p in proteins]
for i, emb in zip(batch_indices, embeddings):
results[i] = emb
return resultsCommon Use Cases
1. Sequence Similarity Analysis
Compute similarity between proteins using embeddings:
import torch
import torch.nn.functional as F
def get_sequence_embedding(model, sequence):
"""Get mean-pooled sequence embedding."""
protein = ESMProtein(sequence=sequence)
tensor = model.encode(protein)
embedding = model.forward(tensor)
# Mean pooling over sequence length
return embedding.mean(dim=1)
# Get embeddings
seq1_emb = get_sequence_embedding(model, "MPRTKEINDAGLIVHSP")
seq2_emb = get_sequence_embedding(model, "MPRTKEINDAGLIVHSQ") # Similar
seq3_emb = get_sequence_embedding(model, "WWWWWWWWWWWWWWWWW") # Different
# Compute cosine similarity
sim_1_2 = F.cosine_similarity(seq1_emb, seq2_emb)
sim_1_3 = F.cosine_similarity(seq1_emb, seq3_emb)
print(f"Similarity (1,2): {sim_1_2.item():.4f}")
print(f"Similarity (1,3): {sim_1_3.item():.4f}")2. Protein Classification
Use embeddings as features for classification:
import numpy as np
from sklearn.linear_model import LogisticRegression
from sklearn.model_selection import train_test_split
# Generate embeddings for training set
def embed_dataset(model, sequences):
embeddings = []
for seq in sequences:
protein = ESMProtein(sequence=seq)
tensor = model.encode(protein)
emb = model.forward(tensor).mean(dim=1) # Mean pooling
embeddings.append(emb.cpu().detach().numpy().flatten())
return np.array(embeddings)
# Example: Classify proteins by function
train_sequences = [...] # Your sequences
train_labels = [...] # Your labels
embeddings = embed_dataset(model, train_sequences)
# Train classifier
X_train, X_test, y_train, y_test = train_test_split(
embeddings, train_labels, test_size=0.2
)
classifier = LogisticRegression(max_iter=1000)
classifier.fit(X_train, y_train)
# Evaluate
accuracy = classifier.score(X_test, y_test)
print(f"Classification accuracy: {accuracy:.4f}")3. Protein Clustering
Cluster proteins based on sequence similarity:
from sklearn.cluster import KMeans
import numpy as np
# Generate embeddings
sequences = [...] # Your protein sequences
embeddings = embed_dataset(model, sequences)
# Cluster
n_clusters = 5
kmeans = KMeans(n_clusters=n_clusters, random_state=42)
cluster_labels = kmeans.fit_predict(embeddings)
# Analyze clusters
for i in range(n_clusters):
cluster_seqs = [seq for seq, label in zip(sequences, cluster_labels) if label == i]
print(f"Cluster {i}: {len(cluster_seqs)} sequences")4. Sequence Search and Retrieval
Find similar sequences in a database:
import torch
import numpy as np
from sklearn.metrics.pairwise import cosine_similarity
def build_sequence_index(model, database_sequences):
"""Build searchable index of sequence embeddings."""
embeddings = []
for seq in database_sequences:
emb = get_sequence_embedding(model, seq)
embeddings.append(emb.cpu().detach().numpy().flatten())
return np.array(embeddings)
def search_similar_sequences(model, query_seq, database_embeddings,
database_sequences, top_k=10):
"""Find top-k most similar sequences."""
query_emb = get_sequence_embedding(model, query_seq)
query_emb_np = query_emb.cpu().detach().numpy().flatten().reshape(1, -1)
# Compute similarities
similarities = cosine_similarity(query_emb_np, database_embeddings)[0]
# Get top-k
top_indices = np.argsort(similarities)[-top_k:][::-1]
results = [
(database_sequences[idx], similarities[idx])
for idx in top_indices
]
return results
# Example usage
database_seqs = [...] # Large sequence database
index = build_sequence_index(model, database_seqs)
query = "MPRTKEINDAGLIVHSP"
similar = search_similar_sequences(model, query, index, database_seqs, top_k=5)
for seq, score in similar:
print(f"Score: {score:.4f} - {seq[:30]}...")5. Feature Extraction for Downstream Models
Use ESM C embeddings as input to custom neural networks:
import torch.nn as nn
class ProteinPropertyPredictor(nn.Module):
"""Example: Predict protein properties from ESM C embeddings."""
def __init__(self, embedding_dim, hidden_dim, output_dim):
super().__init__()
self.fc1 = nn.Linear(embedding_dim, hidden_dim)
self.fc2 = nn.Linear(hidden_dim, hidden_dim)
self.fc3 = nn.Linear(hidden_dim, output_dim)
self.relu = nn.ReLU()
self.dropout = nn.Dropout(0.3)
def forward(self, embeddings):
# embeddings: (batch, seq_len, embedding_dim)
# Mean pool over sequence
x = embeddings.mean(dim=1)
x = self.relu(self.fc1(x))
x = self.dropout(x)
x = self.relu(self.fc2(x))
x = self.dropout(x)
x = self.fc3(x)
return x
# Use ESM C as frozen feature extractor
esm_model = ESMC.from_pretrained("esmc_600m").to("cuda")
esm_model.train(False) # Inference mode (disables dropout; not Python eval)
# Create task-specific model
predictor = ProteinPropertyPredictor(
embedding_dim=1152, # esmc_600m dimension
hidden_dim=512,
output_dim=1 # e.g., stability score
).to("cuda")
# Training loop
for sequence, target in dataloader:
protein = ESMProtein(sequence=sequence)
with torch.no_grad():
embeddings = esm_model.forward(esm_model.encode(protein))
prediction = predictor(embeddings)
loss = criterion(prediction, target)
# ... backprop through predictor only6. Per-Residue Analysis
Extract per-residue representations for detailed analysis:
def get_per_residue_embeddings(model, sequence):
"""Get embedding for each residue."""
protein = ESMProtein(sequence=sequence)
tensor = model.encode(protein)
embeddings = model.forward(tensor)
# embeddings shape: (1, seq_len, hidden_dim)
return embeddings.squeeze(0) # (seq_len, hidden_dim)
# Analyze specific positions
sequence = "MPRTKEINDAGLIVHSPQWFYK"
residue_embeddings = get_per_residue_embeddings(model, sequence)
# Extract features for position 10
position_10_features = residue_embeddings[10]
print(f"Features for residue {sequence[10]} at position 10:")
print(f"Shape: {position_10_features.shape}")
# Compare residue representations
pos_5 = residue_embeddings[5]
pos_15 = residue_embeddings[15]
similarity = F.cosine_similarity(pos_5, pos_15, dim=0)
print(f"Residue similarity: {similarity.item():.4f}")Performance Optimization
Memory Management
import torch
# Use half precision for memory efficiency
model = ESMC.from_pretrained("esmc_600m").to("cuda").half()
# Process with mixed precision
with torch.cuda.amp.autocast():
embeddings = model.forward(model.encode(protein))
# Clear cache between batches
torch.cuda.empty_cache()Batch Processing Best Practices
def efficient_batch_processing(model, sequences, batch_size=32):
"""Process sequences in optimized batches."""
results = []
for i in range(0, len(sequences), batch_size):
batch = sequences[i:i + batch_size]
# Process batch
batch_embeddings = []
for seq in batch:
protein = ESMProtein(sequence=seq)
emb = model.forward(model.encode(protein))
batch_embeddings.append(emb)
results.extend(batch_embeddings)
# Periodically clear cache
if i % (batch_size * 10) == 0:
torch.cuda.empty_cache()
return resultsCaching Embeddings
import pickle
import hashlib
def get_cache_key(sequence):
"""Generate cache key for sequence."""
return hashlib.md5(sequence.encode()).hexdigest()
class EmbeddingCache:
"""Cache for protein embeddings."""
def __init__(self, cache_file="embeddings_cache.pkl"):
self.cache_file = cache_file
try:
with open(cache_file, 'rb') as f:
self.cache = pickle.load(f)
except FileNotFoundError:
self.cache = {}
def get(self, sequence):
key = get_cache_key(sequence)
return self.cache.get(key)
def set(self, sequence, embedding):
key = get_cache_key(sequence)
self.cache[key] = embedding
def save(self):
with open(self.cache_file, 'wb') as f:
pickle.dump(self.cache, f)
# Usage
cache = EmbeddingCache()
def get_embedding_cached(model, sequence):
cached = cache.get(sequence)
if cached is not None:
return cached
# Compute
protein = ESMProtein(sequence=sequence)
embedding = model.forward(model.encode(protein))
cache.set(sequence, embedding)
return embedding
# Don't forget to save cache
cache.save()Comparison with ESM2
Performance Improvements:
| Metric | ESM2-650M | ESM C-600M | Improvement |
|---|---|---|---|
| Inference Speed | 1.0x | 3.0x | 3x faster |
| Perplexity | Higher | Lower | Better |
| Memory Usage | 1.0x | 0.8x | 20% less |
| Embedding Quality | Baseline | Improved | +5-10% |
Migration from ESM2:
ESM C is designed as a modern replacement for many ESM2 embedding workflows:
# Old ESM2 code
from esm import pretrained
model, alphabet = pretrained.esm2_t33_650M_UR50D()
# New ESM C code (similar API)
from esm.models.esmc import ESMC
model = ESMC.from_pretrained("esmc_600m")Key differences:
- Faster inference with same or better quality
- Simplified API through ESMProtein
- Better support for long sequences
- More efficient memory usage
Hosted 6B Embeddings via Forge
The 6B model is available through Forge (not as open local weights). Use LogitsConfig to return embeddings:
import os
from esm.sdk.forge import ESM3ForgeInferenceClient
from esm.sdk.api import ESMProtein, LogitsConfig
client = ESM3ForgeInferenceClient(
model="esmc-6b-2024-12",
url="https://forge.evolutionaryscale.ai",
token=os.environ["ESM_API_KEY"],
)
protein = ESMProtein(sequence="MPRTKEINDAGLIVHSPQWFYK")
protein_tensor = client.encode(protein)
output = client.logits(protein_tensor, LogitsConfig(sequence=True, return_embeddings=True))
embeddings = output.embeddingsSDK v3.2+ also supports mean_hidden_state on forward passes for pooled representations.
Advanced Topics
Fine-tuning ESM C
ESM C can be fine-tuned for specific tasks:
import torch.optim as optim
# Load model
model = ESMC.from_pretrained("esmc_300m").to("cuda")
# Unfreeze for fine-tuning
for param in model.parameters():
param.requires_grad = True
# Define optimizer
optimizer = optim.Adam(model.parameters(), lr=1e-5)
# Training loop
for epoch in range(num_epochs):
for sequences, labels in dataloader:
optimizer.zero_grad()
# Forward pass
proteins = [ESMProtein(sequence=seq) for seq in sequences]
embeddings = [model.forward(model.encode(p)) for p in proteins]
# Your task-specific loss
loss = compute_loss(embeddings, labels)
loss.backward()
optimizer.step()Attention Visualization
Extract attention weights for interpretability:
def get_attention_weights(model, sequence):
"""Extract attention weights from model."""
protein = ESMProtein(sequence=sequence)
tensor = model.encode(protein)
# Forward with attention output
output = model.forward(tensor, output_attentions=True)
return output.attentions # List of attention tensors per layer
# Visualize attention
attentions = get_attention_weights(model, "MPRTKEINDAGLIVHSP")
# Process and visualize attention patternsCitation
If using ESM C in research, cite:
ESM Cambrian: https://www.evolutionaryscale.ai/blog/esm-cambrian
EvolutionaryScale (2024)Additional Resources
- ESM C blog post: https://www.evolutionaryscale.ai/blog/esm-cambrian
- Model weights: HuggingFace EvolutionaryScale organization
- Comparison benchmarks: See blog post for detailed performance comparisons
ESM3 API Reference
Overview
ESM3 is a frontier multimodal generative language model that reasons over the sequence, structure, and function of proteins. It uses iterative masked language modeling to simultaneously generate across these three modalities.
Model Architecture
ESM3 Family Models:
| Model ID | Parameters | Availability | Best For |
|---|---|---|---|
esm3-open | 1.4B | Open weights (local, Hugging Face license acceptance required) | Development, testing, learning |
esm3-medium-2024-08 | 7B | Forge API only | Production, balanced quality/speed |
esm3-large-2024-03 | 98B | Forge API only | Maximum quality, research |
esm3-medium-multimer-2024-09 | 7B | Forge API only | Protein complexes (experimental) |
Key Features:
- Simultaneous reasoning across sequence, structure, and function
- Iterative generation with controllable number of steps
- Support for partial prompting across modalities
- Chain-of-thought generation for complex designs
- Temperature control for generation diversity
Core API Components
ESMProtein Class
The central data structure representing a protein with optional sequence, structure, and function information.
Constructor:
from esm.sdk.api import ESMProtein
protein = ESMProtein(
sequence="MPRTKEINDAGLIVHSP", # Amino acid sequence (optional)
coordinates=coordinates_array, # 3D structure (optional)
function_annotations=[...], # Function labels (optional)
secondary_structure="HHHEEEECCC", # SS annotations (optional)
sasa=sasa_array # Solvent accessibility (optional)
)Key Methods:
# Load from PDB file
protein = ESMProtein.from_pdb("protein.pdb")
# Export to PDB format
pdb_string = protein.to_pdb()
# Save to file
with open("output.pdb", "w") as f:
f.write(protein.to_pdb())Masking Conventions:
Use _ (underscore) to represent masked positions for generation:
# Mask positions 5-10 for generation
protein = ESMProtein(sequence="MPRT______AGLIVHSP")
# Fully masked sequence (generate from scratch)
protein = ESMProtein(sequence="_" * 200)
# Partial structure (some coordinates None)
protein = ESMProtein(
sequence="MPRTKEIND",
coordinates=partial_coords # Some positions can be None
)GenerationConfig Class
Controls generation behavior and parameters.
Basic Configuration:
from esm.sdk.api import GenerationConfig
config = GenerationConfig(
track="sequence", # Track to generate: "sequence", "structure", or "function"
num_steps=8, # Number of demasking steps
temperature=0.7, # Sampling temperature (0.0-1.0)
top_p=None, # Nucleus sampling threshold
condition_on_coordinates_only=False # For structure conditioning
)Parameter Details:
- track: Which modality to generate
"sequence": Generate amino acid sequence"structure": Generate 3D coordinates"function": Generate function annotations
- num_steps: Number of iterative demasking steps
- Higher = slower but potentially better quality
- Typical range: 8-100 depending on sequence length
- For full sequence generation: approximately sequence_length / 2
- temperature: Controls randomness
- 0.0: Fully deterministic (greedy decoding)
- 0.5-0.7: Balanced exploration
- 1.0: Maximum diversity
- Higher values increase novelty but may reduce quality
- top_p: Nucleus sampling parameter
- Limits sampling to top probability mass
- Values: 0.0-1.0 (e.g., 0.9 = sample from top 90% probability mass)
- Use for controlled diversity without extreme sampling
- condition_on_coordinates_only: Structure conditioning mode
True: Condition only on backbone coordinates (ignore sequence)- Useful for inverse folding tasks
ESM3InferenceClient Interface
The unified interface for both local and remote inference.
Local Model Loading:
from esm.models.esm3 import ESM3
# Load with automatic device placement
model = ESM3.from_pretrained("esm3-open").to("cuda")
# Or explicitly specify device
model = ESM3.from_pretrained("esm3-open").to("cpu")Forge API (same interface as local):
import os
import esm
# Drop-in replacement for ESM3.from_pretrained(); reads ESM_API_KEY by default
model = esm.sdk.client("esm3-medium-2024-08", token=os.environ["ESM_API_KEY"])Generation Method:
# Basic generation
protein_output = model.generate(protein_input, config)
# With explicit track specification
protein_output = model.generate(
protein_input,
GenerationConfig(track="sequence", num_steps=16, temperature=0.6)
)Forward Pass (Advanced):
# Get raw model logits for custom sampling
protein_tensor = model.encode(protein)
output = model.forward(protein_tensor)
logits = model.decode(output)Common Usage Patterns
1. Sequence Completion
Fill in masked regions of a protein sequence:
# Define partial sequence
protein = ESMProtein(sequence="MPRTK____LIVHSP____END")
# Generate missing positions
config = GenerationConfig(track="sequence", num_steps=12, temperature=0.5)
completed = model.generate(protein, config)
print(f"Original: {protein.sequence}")
print(f"Completed: {completed.sequence}")2. Structure Prediction
Predict 3D structure from sequence:
# Input: sequence only
protein = ESMProtein(sequence="MPRTKEINDAGLIVHSPQWFYK")
# Generate structure
config = GenerationConfig(track="structure", num_steps=len(protein.sequence))
protein_with_structure = model.generate(protein, config)
# Save as PDB
with open("predicted_structure.pdb", "w") as f:
f.write(protein_with_structure.to_pdb())3. Inverse Folding
Design sequence for a target structure:
# Load target structure
target = ESMProtein.from_pdb("target.pdb")
# Remove sequence, keep structure
target.sequence = None
# Generate sequence that folds to this structure
config = GenerationConfig(
track="sequence",
num_steps=50,
temperature=0.7,
condition_on_coordinates_only=True
)
designed = model.generate(target, config)
print(f"Designed sequence: {designed.sequence}")4. Function-Conditioned Generation
Generate protein with specific function:
from esm.sdk.api import FunctionAnnotation
# Specify desired function
protein = ESMProtein(
sequence="_" * 150,
function_annotations=[
FunctionAnnotation(
label="enzymatic_activity",
start=30,
end=90
)
]
)
# Generate sequence with this function
config = GenerationConfig(track="sequence", num_steps=75, temperature=0.6)
functional_protein = model.generate(protein, config)5. Multi-Track Generation (Chain-of-Thought)
Iteratively generate across multiple tracks:
# Start with partial sequence
protein = ESMProtein(sequence="MPRT" + "_" * 100)
# Step 1: Complete sequence
protein = model.generate(
protein,
GenerationConfig(track="sequence", num_steps=50, temperature=0.6)
)
# Step 2: Predict structure for completed sequence
protein = model.generate(
protein,
GenerationConfig(track="structure", num_steps=50)
)
# Step 3: Predict function
protein = model.generate(
protein,
GenerationConfig(track="function", num_steps=20)
)
print(f"Final sequence: {protein.sequence}")
print(f"Functions: {protein.function_annotations}")6. Variant Generation
Generate multiple variants of a protein:
import numpy as np
base_sequence = "MPRTKEINDAGLIVHSPQWFYK"
variants = []
for i in range(10):
# Mask random positions
seq_list = list(base_sequence)
mask_indices = np.random.choice(len(seq_list), size=5, replace=False)
for idx in mask_indices:
seq_list[idx] = '_'
protein = ESMProtein(sequence=''.join(seq_list))
# Generate variant
variant = model.generate(
protein,
GenerationConfig(track="sequence", num_steps=8, temperature=0.8)
)
variants.append(variant.sequence)
print(f"Generated {len(variants)} variants")Advanced Topics
Temperature Scheduling
Vary temperature during generation for better control:
def generate_with_temperature_schedule(model, protein, temperatures):
"""Generate with decreasing temperature for annealing."""
current = protein
steps_per_temp = 10
for temp in temperatures:
config = GenerationConfig(
track="sequence",
num_steps=steps_per_temp,
temperature=temp
)
current = model.generate(current, config)
return current
# Example: Start diverse, end deterministic
result = generate_with_temperature_schedule(
model,
protein,
temperatures=[1.0, 0.8, 0.6, 0.4, 0.2]
)Constrained Generation
Preserve specific regions during generation:
# Keep active site residues fixed
def mask_except_active_site(sequence, active_site_positions):
"""Mask everything except specified positions."""
seq_list = ['_'] * len(sequence)
for pos in active_site_positions:
seq_list[pos] = sequence[pos]
return ''.join(seq_list)
# Define active site
active_site = [23, 24, 25, 45, 46, 89]
constrained_seq = mask_except_active_site(original_sequence, active_site)
protein = ESMProtein(sequence=constrained_seq)
result = model.generate(protein, GenerationConfig(track="sequence", num_steps=50))Secondary Structure Conditioning
Use secondary structure information in generation:
# Define secondary structure (H=helix, E=sheet, C=coil)
protein = ESMProtein(
sequence="_" * 80,
secondary_structure="CCHHHHHHHEEEEECCCHHHHHHCC" + "C" * 55
)
# Generate sequence with this structure
result = model.generate(
protein,
GenerationConfig(track="sequence", num_steps=40, temperature=0.6)
)Performance Optimization
Memory Management
For large proteins or batch processing:
import torch
# Clear CUDA cache between generations
torch.cuda.empty_cache()
# Use half precision for memory efficiency
model = ESM3.from_pretrained("esm3-open").to("cuda").half()
# Process in chunks for very long sequences
def chunk_generate(model, long_sequence, chunk_size=500):
chunks = [long_sequence[i:i+chunk_size]
for i in range(0, len(long_sequence), chunk_size)]
results = []
for chunk in chunks:
protein = ESMProtein(sequence=chunk)
result = model.generate(protein, GenerationConfig(track="sequence"))
results.append(result.sequence)
return ''.join(results)Batch Processing Tips
When processing multiple proteins:
1. Sort by sequence length for efficient batching 2. Use padding for similar-length sequences 3. Process on GPU when available 4. Implement checkpointing for long-running jobs 5. Use Forge API for large-scale processing (see forge-api.md)
Error Handling
try:
protein = model.generate(protein_input, config)
except ValueError as e:
print(f"Invalid input: {e}")
# Handle invalid sequence or structure
except RuntimeError as e:
print(f"Generation failed: {e}")
# Handle model errors
except torch.cuda.OutOfMemoryError:
print("GPU out of memory - try smaller model or CPU")
# Fallback to CPU or smaller modelModel-Specific Considerations
esm3-open:
- Suitable for development and testing
- Lower quality than larger models
- Fast inference on consumer GPUs
- Open weights allow fine-tuning
esm3-medium-2024-08:
- Production quality
- Good balance of speed and accuracy
- Requires Forge API access
- Recommended for most applications
esm3-large-2024-03:
- State-of-the-art quality
- Slowest inference
- Use for critical applications
- Best for novel protein design
Citation
If using ESM3 in research, cite:
Hayes, T. et al. (2025). Simulating 500 million years of evolution with a language model.
Science. DOI: 10.1126/science.ads0018Forge and Hosted API Reference
Overview
Forge is EvolutionaryScale's hosted platform for scalable ESM3 and ESMC inference. Biohub is the current platform surface for newer hosted workflows such as ESMFold2; SDK classes may still use forge names even when the endpoint is https://biohub.ai.
Key Benefits:
- Access to all ESM3 models including 98B parameter version
- No local GPU requirements
- Scalable batch processing
- Automatic updates to latest models
- Production-ready infrastructure
- Async/concurrent request support
Getting Started
1. Obtain API Token
Create a token in the Biohub developer console for Biohub APIs. For legacy Forge-hosted ESM3/ESMC access, use https://forge.evolutionaryscale.ai.
2. Install ESM SDK
uv pip install "esm==3.2.3"Requires Python 3.12. The Forge client is included in the standard PyPI package.
3. Set API Key
Export your API key (never hardcode in source files):
export ESM_API_KEY="your-key-from-console"esm.sdk.client() reads ESM_API_KEY by default when token is omitted. Keep API hosts fixed to trusted endpoints such as https://forge.evolutionaryscale.ai and https://biohub.ai; do not accept an arbitrary endpoint URL from untrusted input.
4. Basic Connection
Recommended (unified client):
import os
import esm
from esm.sdk.api import ESMProtein, GenerationConfig
client = esm.sdk.client("esm3-medium-2024-08", token=os.environ["ESM_API_KEY"])Explicit Forge client (equivalent):
import os
from esm.sdk.forge import ESM3ForgeInferenceClient
from esm.sdk.api import ESMProtein, GenerationConfig
client = ESM3ForgeInferenceClient(
model="esm3-medium-2024-08",
url="https://forge.evolutionaryscale.ai",
token=os.environ["ESM_API_KEY"],
)
# Test connection
protein = ESMProtein(sequence="MPRT___KEND")
result = client.generate(protein, GenerationConfig(track="sequence", num_steps=8))
print(result.sequence)Available Models
| Model ID | Parameters | Speed | Quality | Use Case |
|---|---|---|---|---|
esm3-small-2024-08 | 1.4B | Fastest | Good | Rapid prototyping, testing |
esm3-medium-2024-08 | 7B | Fast | Excellent | Production, most applications |
esm3-large-2024-03 | 98B | Slower | Best | Research, critical designs |
esm3-medium-multimer-2024-09 | 7B | Fast | Experimental | Protein complexes |
Model Selection Guidelines:
- Development/Testing: Use
esm3-small-2024-08for quick iteration - Production: Use
esm3-medium-2024-08for best balance - Research/Critical: Use
esm3-large-2024-03for highest quality - Complexes: Use
esm3-medium-multimer-2024-09(experimental)
ESM3ForgeInferenceClient API
Initialization
import os
import esm
from esm.sdk.forge import ESM3ForgeInferenceClient
token = os.environ["ESM_API_KEY"]
# Recommended shorthand
client = esm.sdk.client("esm3-medium-2024-08", token=token)
# With custom URL (enterprise deployments)
client = ESM3ForgeInferenceClient(
model="esm3-medium-2024-08",
url="https://custom.forge.instance.com",
token=token,
)
# With request timeout (seconds)
client = esm.sdk.client("esm3-medium-2024-08", token=token, request_timeout=300)Synchronous Generation
Standard blocking generation calls:
from esm.sdk.api import ESMProtein, GenerationConfig
# Basic generation
protein = ESMProtein(sequence="MPRT___KEND")
config = GenerationConfig(track="sequence", num_steps=8)
result = client.generate(protein, config)
print(f"Generated: {result.sequence}")Asynchronous Generation
For concurrent processing of multiple proteins:
import asyncio
from esm.sdk.api import ESMProtein, GenerationConfig
async def generate_many(client, proteins):
"""Generate multiple proteins concurrently."""
tasks = []
for protein in proteins:
task = client.async_generate(
protein,
GenerationConfig(track="sequence", num_steps=8)
)
tasks.append(task)
results = await asyncio.gather(*tasks)
return results
# Usage
proteins = [
ESMProtein(sequence=f"MPRT{'_' * 10}KEND"),
ESMProtein(sequence=f"AGLV{'_' * 10}HSPQ"),
ESMProtein(sequence=f"KEIT{'_' * 10}NDFL")
]
results = asyncio.run(generate_many(client, proteins))
print(f"Generated {len(results)} proteins")Batch Processing with Async Concurrency
For large-scale processing, combine the SDK's async methods with an explicit concurrency limit:
import asyncio
from esm.sdk.api import ESMProtein, GenerationConfig
async def generate_many_limited(client, proteins, config, max_concurrent=10):
semaphore = asyncio.Semaphore(max_concurrent)
async def run_one(protein):
async with semaphore:
return await client.async_generate(protein, config)
return await asyncio.gather(*(run_one(protein) for protein in proteins))
# Prepare batch of proteins
proteins = [ESMProtein(sequence=f"MPRT{'_' * 50}KEND") for _ in range(100)]
config = GenerationConfig(track="sequence", num_steps=25)
batch_results = asyncio.run(generate_many_limited(client, proteins, config))
print(f"Completed {len(batch_results)} generations")Rate Limiting and Quotas
Understanding Limits
Hosted APIs may rate limit based on:
- Requests per minute (RPM)
- Tokens per minute (TPM)
- Concurrent requests
Check the Forge or Biohub console for your current credits, model access, and rate limits; do not bake assumed limits into production code.
Handling Rate Limits
import time
from requests.exceptions import HTTPError
def generate_with_retry(client, protein, config, max_retries=3):
"""Generate with automatic retry on rate limit."""
for attempt in range(max_retries):
try:
return client.generate(protein, config)
except HTTPError as e:
if e.response.status_code == 429: # Rate limit
wait_time = 2 ** attempt # Exponential backoff
print(f"Rate limited, waiting {wait_time}s...")
time.sleep(wait_time)
else:
raise
raise Exception("Max retries exceeded")
# Usage
result = generate_with_retry(client, protein, config)Implementing Custom Rate Limiter
import time
from collections import deque
class RateLimiter:
"""Simple rate limiter for API calls."""
def __init__(self, max_per_minute=60):
self.max_per_minute = max_per_minute
self.calls = deque()
def wait_if_needed(self):
"""Wait if rate limit would be exceeded."""
now = time.time()
# Remove old calls
while self.calls and self.calls[0] < now - 60:
self.calls.popleft()
# Wait if at limit
if len(self.calls) >= self.max_per_minute:
sleep_time = 60 - (now - self.calls[0])
if sleep_time > 0:
time.sleep(sleep_time)
self.calls.popleft()
self.calls.append(now)
# Usage
limiter = RateLimiter(max_per_minute=60)
for protein in proteins:
limiter.wait_if_needed()
result = client.generate(protein, config)Advanced Patterns
Streaming Results
Process results as they complete:
import asyncio
async def stream_generate(client, proteins, config):
"""Stream results as they complete."""
task_to_index = {
asyncio.create_task(client.async_generate(p, config)): i
for i, p in enumerate(proteins)
}
pending_tasks = set(task_to_index)
results = [None] * len(proteins)
while pending_tasks:
done, pending_tasks = await asyncio.wait(
pending_tasks,
return_when=asyncio.FIRST_COMPLETED
)
for task in done:
idx = task_to_index[task]
result = await task
results[idx] = result
yield idx, result
# Usage
async def process_stream():
async for idx, result in stream_generate(client, proteins, config):
print(f"Completed protein {idx}: {result.sequence[:20]}...")
asyncio.run(process_stream())Batch with Progress Tracking
from tqdm import tqdm
import asyncio
async def batch_with_progress(client, proteins, config):
"""Process batch with progress bar."""
results = []
with tqdm(total=len(proteins)) as pbar:
for protein in proteins:
result = await client.async_generate(protein, config)
results.append(result)
pbar.update(1)
return results
# Usage
results = asyncio.run(batch_with_progress(client, proteins, config))Checkpoint and Resume
For long-running batch jobs:
import pickle
import os
class CheckpointedBatchProcessor:
"""Batch processor with checkpoint/resume capability."""
def __init__(self, client, checkpoint_file="checkpoint.pkl"):
self.client = client
self.checkpoint_file = checkpoint_file
self.completed = self.load_checkpoint()
def load_checkpoint(self):
if os.path.exists(self.checkpoint_file):
with open(self.checkpoint_file, 'rb') as f:
return pickle.load(f)
return {}
def save_checkpoint(self):
with open(self.checkpoint_file, 'wb') as f:
pickle.dump(self.completed, f)
def process_batch(self, proteins, config):
"""Process batch with checkpointing."""
results = {}
for i, protein in enumerate(proteins):
# Skip if already completed
if i in self.completed:
results[i] = self.completed[i]
continue
try:
result = self.client.generate(protein, config)
results[i] = result
self.completed[i] = result
# Save checkpoint every 10 items
if i % 10 == 0:
self.save_checkpoint()
except Exception as e:
print(f"Error processing {i}: {e}")
self.save_checkpoint()
raise
self.save_checkpoint()
return results
# Usage
processor = CheckpointedBatchProcessor(client)
results = processor.process_batch(proteins, config)Error Handling
Common Errors and Solutions
from requests.exceptions import HTTPError, ConnectionError, Timeout
def robust_generate(client, protein, config):
"""Generate with comprehensive error handling."""
try:
return client.generate(protein, config)
except HTTPError as e:
if e.response.status_code == 401:
raise ValueError("Invalid API token")
elif e.response.status_code == 429:
raise ValueError("Rate limit exceeded - slow down requests")
elif e.response.status_code == 500:
raise ValueError("Server error - try again later")
else:
raise
except ConnectionError:
raise ValueError("Network error - check internet connection")
except Timeout:
raise ValueError("Request timeout - try smaller protein or increase timeout")
except Exception as e:
raise ValueError(f"Unexpected error: {str(e)}")
# Usage with retry logic
def generate_with_full_retry(client, protein, config, max_retries=3):
"""Combine error handling with retry logic."""
for attempt in range(max_retries):
try:
return robust_generate(client, protein, config)
except ValueError as e:
if "rate limit" in str(e).lower() and attempt < max_retries - 1:
time.sleep(2 ** attempt)
continue
raiseCost Optimization
Strategies to Reduce Costs
1. Use Appropriate Model Size:
# Use smaller model for testing
dev_client = ESM3ForgeInferenceClient(
model="esm3-small-2024-08",
token=token
)
# Use larger model only for final generation
prod_client = ESM3ForgeInferenceClient(
model="esm3-large-2024-03",
token=token
)2. Cache Results:
import hashlib
import json
class ForgeCache:
"""Cache Forge API results locally."""
def __init__(self, cache_dir="forge_cache"):
self.cache_dir = cache_dir
os.makedirs(cache_dir, exist_ok=True)
def get_cache_key(self, protein, config):
"""Generate cache key from inputs."""
data = {
'sequence': protein.sequence,
'config': str(config)
}
return hashlib.md5(json.dumps(data, sort_keys=True).encode()).hexdigest()
def get(self, protein, config):
"""Get cached result."""
key = self.get_cache_key(protein, config)
path = os.path.join(self.cache_dir, f"{key}.pkl")
if os.path.exists(path):
with open(path, 'rb') as f:
return pickle.load(f)
return None
def set(self, protein, config, result):
"""Cache result."""
key = self.get_cache_key(protein, config)
path = os.path.join(self.cache_dir, f"{key}.pkl")
with open(path, 'wb') as f:
pickle.dump(result, f)
# Usage
cache = ForgeCache()
def cached_generate(client, protein, config):
"""Generate with caching."""
cached = cache.get(protein, config)
if cached:
return cached
result = client.generate(protein, config)
cache.set(protein, config, result)
return result3. Batch Similar Requests:
Group similar generation tasks to reduce overhead:
def batch_similar_tasks(proteins, max_batch_size=50):
"""Group proteins by similar properties."""
# Sort by length for efficient processing
sorted_proteins = sorted(proteins, key=lambda p: len(p.sequence))
batches = []
current_batch = []
for protein in sorted_proteins:
current_batch.append(protein)
if len(current_batch) >= max_batch_size:
batches.append(current_batch)
current_batch = []
if current_batch:
batches.append(current_batch)
return batchesMonitoring and Logging
Track API Usage
import logging
from datetime import datetime
class ForgeMonitor:
"""Monitor Forge API usage."""
def __init__(self):
self.calls = []
self.errors = []
def log_call(self, model, protein_length, duration, success=True, error=None):
"""Log API call."""
entry = {
'timestamp': datetime.now(),
'model': model,
'protein_length': protein_length,
'duration': duration,
'success': success,
'error': str(error) if error else None
}
if success:
self.calls.append(entry)
else:
self.errors.append(entry)
def get_stats(self):
"""Get usage statistics."""
total_calls = len(self.calls) + len(self.errors)
success_rate = len(self.calls) / total_calls if total_calls > 0 else 0
avg_duration = sum(c['duration'] for c in self.calls) / len(self.calls) if self.calls else 0
return {
'total_calls': total_calls,
'successful': len(self.calls),
'failed': len(self.errors),
'success_rate': success_rate,
'avg_duration': avg_duration
}
# Usage
monitor = ForgeMonitor()
def monitored_generate(client, protein, config):
"""Generate with monitoring."""
start = time.time()
try:
result = client.generate(protein, config)
duration = time.time() - start
monitor.log_call(
model=client.model,
protein_length=len(protein.sequence),
duration=duration,
success=True
)
return result
except Exception as e:
duration = time.time() - start
monitor.log_call(
model=client.model,
protein_length=len(protein.sequence),
duration=duration,
success=False,
error=e
)
raise
# Check stats
print(monitor.get_stats())AWS SageMaker Deployment
For dedicated infrastructure and enterprise use:
Deployment Options
1. AWS Marketplace Listing: Deploy ESM3 via AWS SageMaker Marketplace 2. Custom Endpoint: Configure dedicated inference endpoint 3. Batch Transform: Use SageMaker Batch Transform for large-scale processing
Benefits
- Dedicated compute resources
- No rate limiting beyond your infrastructure
- Data stays in your AWS environment
- Integration with AWS services
- Custom instance types and scaling
More Information:
- AWS Marketplace: https://aws.amazon.com/marketplace/seller-profile?id=seller-iw2nbscescndm
- Contact EvolutionaryScale for enterprise licensing
Best Practices Summary
1. Authentication: Use ESM_API_KEY environment variable or a secrets manager; never hardcode tokens 2. Rate Limiting: Implement exponential backoff and respect limits 3. Error Handling: Always handle network errors and retries 4. Caching: Cache results for repeated queries 5. Model Selection: Use appropriate model size for task 6. Batch Processing: Use async/batch processing for multiple proteins 7. Monitoring: Track usage and costs 8. Checkpointing: Save progress for long-running jobs
Troubleshooting
Connection Issues
# Test connection
try:
client = ESM3ForgeInferenceClient(model="esm3-medium-2024-08", token=token)
test_protein = ESMProtein(sequence="MPRTK")
result = client.generate(test_protein, GenerationConfig(track="sequence", num_steps=1))
print("Connection successful!")
except Exception as e:
print(f"Connection failed: {e}")Token Validation
def validate_token(token):
"""Validate API token."""
try:
client = ESM3ForgeInferenceClient(
model="esm3-small-2024-08",
token=token
)
# Make minimal test call
test = ESMProtein(sequence="MPR")
client.generate(test, GenerationConfig(track="sequence", num_steps=1))
return True
except HTTPError as e:
if e.response.status_code == 401:
return False
raiseBiohub Migration
Some newer APIs (notably ESMFold2 structure prediction) run on biohub.ai while SDK modules still use esm.sdk.forge naming. See biohub-platform.md for ESMFold2 setup and Biohub developer-console authentication.
Additional Resources
- Forge Platform: https://forge.evolutionaryscale.ai
- Biohub Platform: https://biohub.ai
- API Documentation: Check Forge or Biohub dashboard for latest API specs
- Community Support: Slack community at https://bit.ly/3FKwcWd
- Enterprise Contact: Contact EvolutionaryScale for custom deployments
ESM Workflows and Examples
Overview
This document provides complete, end-to-end examples of common workflows using ESM3 and ESM C. Each workflow includes setup, execution, and analysis code.
Workflow 1: Novel GFP Design with Chain-of-Thought
Design a novel fluorescent protein using ESM3's multimodal generation capabilities.
Objective
Generate a green fluorescent protein (GFP) with specific properties using chain-of-thought reasoning across sequence, structure, and function.
Complete Implementation
from esm.models.esm3 import ESM3
from esm.sdk.api import ESMProtein, GenerationConfig, FunctionAnnotation
import matplotlib.pyplot as plt
# Setup
model = ESM3.from_pretrained("esm3-open").to("cuda")
# Step 1: Define target properties
print("Step 1: Defining target GFP properties...")
# Create protein with desired function
target_length = 238 # Typical GFP length
protein = ESMProtein(
sequence="_" * target_length,
function_annotations=[
FunctionAnnotation(
label="green_fluorescent_protein",
start=65,
end=75 # Chromophore region
)
]
)
# Step 2: Generate initial sequence with function conditioning
print("Step 2: Generating initial sequence...")
config = GenerationConfig(
track="sequence",
num_steps=target_length // 3, # Gradual generation
temperature=0.7 # Moderate diversity
)
protein = model.generate(protein, config)
print(f"Generated sequence: {protein.sequence[:50]}...")
# Step 3: Predict structure
print("Step 3: Predicting structure...")
config = GenerationConfig(
track="structure",
num_steps=target_length // 2
)
protein = model.generate(protein, config)
print(f"Structure predicted, coordinates shape: {protein.coordinates.shape}")
# Step 4: Refine sequence based on structure
print("Step 4: Refining sequence based on structure...")
# Mask regions for refinement (e.g., surface residues)
sequence_list = list(protein.sequence)
# Keep chromophore region, refine others
for i in range(0, 65):
if i % 3 == 0: # Refine every third position
sequence_list[i] = '_'
for i in range(75, target_length):
if i % 3 == 0:
sequence_list[i] = '_'
protein.sequence = ''.join(sequence_list)
config = GenerationConfig(
track="sequence",
num_steps=50,
temperature=0.5 # Lower temperature for refinement
)
protein = model.generate(protein, config)
# Step 5: Final validation
print("Step 5: Final validation...")
# Predict final structure
config = GenerationConfig(track="structure", num_steps=30)
protein = model.generate(protein, config)
# Save results
with open("novel_gfp.pdb", "w") as f:
f.write(protein.to_pdb())
with open("novel_gfp_sequence.txt", "w") as f:
f.write(f">Novel_GFP\n{protein.sequence}\n")
print(f"\nFinal GFP sequence:\n{protein.sequence}")
print(f"\nFunction annotations: {protein.function_annotations}")
print(f"Structure saved to: novel_gfp.pdb")Validation Steps
# Analyze designed GFP
def analyze_gfp(protein):
"""Analyze generated GFP properties."""
# Check chromophore region (should be around Ser65-Tyr66-Gly67)
chromophore_region = protein.sequence[64:68]
print(f"Chromophore region: {chromophore_region}")
# Check barrel structure (GFPs have beta-barrel)
# Analyze secondary structure if available
if protein.secondary_structure:
beta_content = protein.secondary_structure.count('E') / len(protein.sequence)
print(f"Beta sheet content: {beta_content:.2%}")
# Check sequence similarity to known GFPs
# (Would require BLAST or alignment tool in practice)
return {
'length': len(protein.sequence),
'chromophore': chromophore_region,
'coordinates_available': protein.coordinates is not None
}
analysis = analyze_gfp(protein)
print(f"\nAnalysis results: {analysis}")Workflow 2: Protein Variant Library Generation
Generate and analyze a library of protein variants for directed evolution.
Objective
Create variants of a parent protein by targeted mutagenesis while maintaining structural integrity.
Complete Implementation
from esm.models.esm3 import ESM3
from esm.sdk.api import ESMProtein, GenerationConfig
import numpy as np
from sklearn.cluster import KMeans
# Setup
model = ESM3.from_pretrained("esm3-open").to("cuda")
# Parent protein
parent_sequence = "MPRTKEINDAGLIVHSPQWFYKARNDTESLGKIVHEFPM"
parent_protein = ESMProtein(sequence=parent_sequence)
# Define mutation parameters
num_variants = 50
positions_to_mutate = 5 # Number of positions per variant
# Step 1: Generate variant library
print("Generating variant library...")
variants = []
for i in range(num_variants):
# Create masked sequence with random positions
seq_list = list(parent_sequence)
# Select random positions to mutate
mutation_positions = np.random.choice(
len(seq_list),
size=positions_to_mutate,
replace=False
)
for pos in mutation_positions:
seq_list[pos] = '_'
# Generate variant
variant_protein = ESMProtein(sequence=''.join(seq_list))
config = GenerationConfig(
track="sequence",
num_steps=positions_to_mutate * 2,
temperature=0.8 # Higher diversity
)
variant = model.generate(variant_protein, config)
variants.append(variant.sequence)
if (i + 1) % 10 == 0:
print(f"Generated {i + 1}/{num_variants} variants")
print(f"\nGenerated {len(variants)} variants")
# Step 2: Predict structures for variants
print("\nPredicting structures...")
variant_proteins_with_structure = []
for i, seq in enumerate(variants):
protein = ESMProtein(sequence=seq)
config = GenerationConfig(
track="structure",
num_steps=len(seq) // 2
)
protein_with_structure = model.generate(protein, config)
variant_proteins_with_structure.append(protein_with_structure)
if (i + 1) % 10 == 0:
print(f"Predicted structures for {i + 1}/{len(variants)} variants")
# Step 3: Analyze variant diversity
print("\nAnalyzing variant diversity...")
# Calculate Hamming distances from parent
def hamming_distance(seq1, seq2):
"""Calculate Hamming distance between sequences."""
return sum(c1 != c2 for c1, c2 in zip(seq1, seq2))
distances = [hamming_distance(parent_sequence, var) for var in variants]
print(f"Average mutations per variant: {np.mean(distances):.1f}")
print(f"Mutation range: {min(distances)}-{max(distances)}")
# Step 4: Get embeddings for clustering
print("\nGenerating embeddings for clustering...")
from esm.models.esmc import ESMC
embedding_model = ESMC.from_pretrained("esmc_300m").to("cuda")
def get_embedding(sequence):
"""Get mean-pooled embedding for sequence."""
protein = ESMProtein(sequence=sequence)
tensor = embedding_model.encode(protein)
emb = embedding_model.forward(tensor)
return emb.mean(dim=1).cpu().detach().numpy().flatten()
variant_embeddings = np.array([get_embedding(seq) for seq in variants])
# Step 5: Cluster variants
print("Clustering variants...")
n_clusters = 5
kmeans = KMeans(n_clusters=n_clusters, random_state=42)
cluster_labels = kmeans.fit_predict(variant_embeddings)
# Analyze clusters
print("\nCluster analysis:")
for i in range(n_clusters):
cluster_variants = [var for var, label in zip(variants, cluster_labels) if label == i]
cluster_distances = [hamming_distance(parent_sequence, var) for var in cluster_variants]
print(f"\nCluster {i}:")
print(f" Size: {len(cluster_variants)}")
print(f" Avg distance from parent: {np.mean(cluster_distances):.1f}")
print(f" Representative: {cluster_variants[0][:40]}...")
# Step 6: Select diverse representatives
print("\nSelecting diverse representatives...")
representatives = []
for i in range(n_clusters):
# Get centroid
cluster_indices = np.where(cluster_labels == i)[0]
cluster_embs = variant_embeddings[cluster_indices]
# Find closest to centroid
centroid = cluster_embs.mean(axis=0)
distances_to_centroid = np.linalg.norm(cluster_embs - centroid, axis=1)
rep_idx = cluster_indices[np.argmin(distances_to_centroid)]
representatives.append(variants[rep_idx])
# Save results
print("\nSaving results...")
with open("variant_library.fasta", "w") as f:
f.write(f">Parent\n{parent_sequence}\n\n")
for i, var in enumerate(variants):
f.write(f">Variant_{i+1}_Cluster_{cluster_labels[i]}\n{var}\n")
with open("representative_variants.fasta", "w") as f:
for i, rep in enumerate(representatives):
f.write(f">Representative_Cluster_{i}\n{rep}\n")
print("Variant library saved to: variant_library.fasta")
print("Representatives saved to: representative_variants.fasta")Workflow 3: Structure-Based Sequence Optimization
Optimize a protein sequence to improve stability while maintaining function.
Objective
Given a protein structure, design sequences that maintain the fold but have improved properties.
Complete Implementation
from esm.models.esm3 import ESM3
from esm.sdk.api import ESMProtein, GenerationConfig
import numpy as np
# Setup
model = ESM3.from_pretrained("esm3-open").to("cuda")
# Load target structure (e.g., from PDB)
target_protein = ESMProtein.from_pdb("target_structure.pdb")
original_sequence = target_protein.sequence
print(f"Original sequence: {original_sequence}")
print(f"Structure loaded: {target_protein.coordinates.shape}")
# Step 1: Generate multiple sequence designs
print("\nGenerating optimized sequences...")
num_designs = 20
optimized_sequences = []
for i in range(num_designs):
# Start with structure, remove sequence
design_protein = ESMProtein(
coordinates=target_protein.coordinates.copy(),
secondary_structure=target_protein.secondary_structure
)
# Generate sequence for this structure
config = GenerationConfig(
track="sequence",
num_steps=len(original_sequence),
temperature=0.7,
condition_on_coordinates_only=True
)
designed = model.generate(design_protein, config)
optimized_sequences.append(designed.sequence)
if (i + 1) % 5 == 0:
print(f"Generated {i + 1}/{num_designs} designs")
# Step 2: Validate structural compatibility
print("\nValidating structural compatibility...")
validated_designs = []
for seq in optimized_sequences:
# Predict structure for designed sequence
test_protein = ESMProtein(sequence=seq)
config = GenerationConfig(
track="structure",
num_steps=len(seq) // 2
)
predicted = model.generate(test_protein, config)
# Calculate RMSD (simplified - in practice use proper alignment)
# Here we just check if structure prediction succeeds
if predicted.coordinates is not None:
validated_designs.append(seq)
print(f"Validated {len(validated_designs)}/{num_designs} designs")
# Step 3: Analyze sequence properties
print("\nAnalyzing sequence properties...")
def calculate_properties(sequence):
"""Calculate basic sequence properties."""
# Hydrophobicity (simplified)
hydrophobic = "AILMFWYV"
hydrophobic_fraction = sum(1 for aa in sequence if aa in hydrophobic) / len(sequence)
# Charge
positive = "KR"
negative = "DE"
net_charge = sum(1 for aa in sequence if aa in positive) - sum(1 for aa in sequence if aa in negative)
# Aromatic content
aromatic = "FWY"
aromatic_fraction = sum(1 for aa in sequence if aa in aromatic) / len(sequence)
return {
'hydrophobic_fraction': hydrophobic_fraction,
'net_charge': net_charge,
'aromatic_fraction': aromatic_fraction
}
# Compare to original
original_props = calculate_properties(original_sequence)
print(f"\nOriginal properties:")
print(f" Hydrophobic: {original_props['hydrophobic_fraction']:.2%}")
print(f" Net charge: {original_props['net_charge']:+d}")
print(f" Aromatic: {original_props['aromatic_fraction']:.2%}")
# Analyze designs
design_properties = [calculate_properties(seq) for seq in validated_designs]
avg_hydrophobic = np.mean([p['hydrophobic_fraction'] for p in design_properties])
avg_charge = np.mean([p['net_charge'] for p in design_properties])
avg_aromatic = np.mean([p['aromatic_fraction'] for p in design_properties])
print(f"\nDesigned sequences (average):")
print(f" Hydrophobic: {avg_hydrophobic:.2%}")
print(f" Net charge: {avg_charge:+.1f}")
print(f" Aromatic: {avg_aromatic:.2%}")
# Step 4: Rank designs
print("\nRanking designs...")
def score_design(sequence, original_props):
"""Score design based on desired properties."""
props = calculate_properties(sequence)
# Prefer higher hydrophobic content (for stability)
hydrophobic_score = props['hydrophobic_fraction']
# Prefer similar charge to original
charge_score = 1.0 / (1.0 + abs(props['net_charge'] - original_props['net_charge']))
# Combined score
return hydrophobic_score * 0.6 + charge_score * 0.4
scores = [(seq, score_design(seq, original_props)) for seq in validated_designs]
scores.sort(key=lambda x: x[1], reverse=True)
print("\nTop 5 designs:")
for i, (seq, score) in enumerate(scores[:5]):
print(f"\n{i+1}. Score: {score:.3f}")
print(f" Sequence: {seq[:40]}...")
# Step 5: Save results
print("\nSaving results...")
with open("optimized_sequences.fasta", "w") as f:
f.write(f">Original\n{original_sequence}\n\n")
for i, (seq, score) in enumerate(scores):
props = calculate_properties(seq)
f.write(f">Design_{i+1}_Score_{score:.3f}\n")
f.write(f"# Hydrophobic: {props['hydrophobic_fraction']:.2%}, ")
f.write(f"Charge: {props['net_charge']:+d}, ")
f.write(f"Aromatic: {props['aromatic_fraction']:.2%}\n")
f.write(f"{seq}\n\n")
print("Results saved to: optimized_sequences.fasta")Workflow 4: Function Prediction Pipeline
Predict protein function from sequence using ESM3 and ESM C.
Objective
Build a pipeline that predicts protein function using both generative (ESM3) and embedding (ESM C) approaches.
Complete Implementation
from esm.models.esm3 import ESM3
from esm.models.esmc import ESMC
from esm.sdk.api import ESMProtein, GenerationConfig
import numpy as np
from sklearn.ensemble import RandomForestClassifier
from sklearn.model_selection import cross_val_score
# Setup models
esm3_model = ESM3.from_pretrained("esm3-open").to("cuda")
esmc_model = ESMC.from_pretrained("esmc_600m").to("cuda")
# Example: Predict if protein is an enzyme
# (In practice, you'd have a labeled training set)
def predict_function_generative(sequence):
"""Predict function using ESM3 generative approach."""
protein = ESMProtein(sequence=sequence)
# Generate function annotations
config = GenerationConfig(
track="function",
num_steps=20,
temperature=0.3 # Low temperature for confident predictions
)
protein_with_function = esm3_model.generate(protein, config)
return protein_with_function.function_annotations
def predict_function_embedding(sequence, function_classifier):
"""Predict function using ESM C embeddings + classifier."""
# Get embedding
protein = ESMProtein(sequence=sequence)
tensor = esmc_model.encode(protein)
embedding = esmc_model.forward(tensor)
# Mean pool
embedding_pooled = embedding.mean(dim=1).cpu().detach().numpy()
# Predict with classifier
prediction = function_classifier.predict(embedding_pooled)
probability = function_classifier.predict_proba(embedding_pooled)
return prediction[0], probability[0]
# Example workflow with test sequences
test_sequences = {
"kinase": "MPRTKEINDAGLIVHSPQWFYKARNDTESLGKIVHEF",
"protease": "AGLIVHSPQWFYKARNDTESLGKIVHEFPMCDEGH",
"transporter": "KTEFLNDGRPMLIVHSPQWFYKARNDTESLGKIVH"
}
print("Predicting functions...\n")
for name, sequence in test_sequences.items():
print(f"{name.upper()}:")
print(f"Sequence: {sequence[:30]}...")
# Method 1: Generative
functions = predict_function_generative(sequence)
print(f" Generative predictions: {functions}")
# Method 2: Embedding-based would require trained classifier
# (Skipped in this example as it needs training data)
print()Workflow 5: Embedding-Based Clustering and Analysis
Cluster and analyze a large protein dataset using ESM C embeddings.
Complete Implementation
from esm.models.esmc import ESMC
from esm.sdk.api import ESMProtein
import numpy as np
from sklearn.cluster import DBSCAN
from sklearn.decomposition import PCA
from sklearn.manifold import TSNE
import matplotlib.pyplot as plt
# Setup
model = ESMC.from_pretrained("esmc_600m").to("cuda")
# Load protein dataset (example)
sequences = [
# In practice, load from FASTA or database
"MPRTKEINDAGLIVHSPQWFYK",
"AGLIVHSPQWFYKARNDTESL",
# ... more sequences
]
print(f"Loaded {len(sequences)} sequences")
# Step 1: Generate embeddings
print("Generating embeddings...")
embeddings = []
for i, seq in enumerate(sequences):
protein = ESMProtein(sequence=seq)
tensor = model.encode(protein)
emb = model.forward(tensor)
# Mean pooling
emb_pooled = emb.mean(dim=1).cpu().detach().numpy().flatten()
embeddings.append(emb_pooled)
if (i + 1) % 100 == 0:
print(f"Processed {i + 1}/{len(sequences)}")
embeddings = np.array(embeddings)
print(f"Embeddings shape: {embeddings.shape}")
# Step 2: Dimensionality reduction for visualization
print("\nReducing dimensionality...")
# PCA for initial reduction
pca = PCA(n_components=50)
embeddings_pca = pca.fit_transform(embeddings)
print(f"PCA explained variance: {pca.explained_variance_ratio_[:10].sum():.2%}")
# t-SNE for visualization
tsne = TSNE(n_components=2, random_state=42)
embeddings_2d = tsne.fit_transform(embeddings_pca)
# Step 3: Clustering
print("\nClustering...")
# DBSCAN for density-based clustering
clustering = DBSCAN(eps=0.5, min_samples=5)
cluster_labels = clustering.fit_predict(embeddings)
n_clusters = len(set(cluster_labels)) - (1 if -1 in cluster_labels else 0)
n_noise = list(cluster_labels).count(-1)
print(f"Number of clusters: {n_clusters}")
print(f"Number of noise points: {n_noise}")
# Step 4: Visualize
print("\nGenerating visualization...")
plt.figure(figsize=(12, 8))
scatter = plt.scatter(
embeddings_2d[:, 0],
embeddings_2d[:, 1],
c=cluster_labels,
cmap='viridis',
alpha=0.6
)
plt.colorbar(scatter)
plt.title("Protein Sequence Clustering (ESM C Embeddings)")
plt.xlabel("t-SNE 1")
plt.ylabel("t-SNE 2")
plt.savefig("protein_clusters.png", dpi=300, bbox_inches='tight')
print("Visualization saved to: protein_clusters.png")
# Step 5: Analyze clusters
print("\nCluster analysis:")
for cluster_id in range(n_clusters):
cluster_indices = np.where(cluster_labels == cluster_id)[0]
cluster_seqs = [sequences[i] for i in cluster_indices]
print(f"\nCluster {cluster_id}:")
print(f" Size: {len(cluster_seqs)}")
print(f" Avg length: {np.mean([len(s) for s in cluster_seqs]):.1f}")
print(f" Example: {cluster_seqs[0][:40]}...")
# Save cluster assignments
with open("cluster_assignments.txt", "w") as f:
for i, (seq, label) in enumerate(zip(sequences, cluster_labels)):
f.write(f"Sequence_{i}\tCluster_{label}\t{seq}\n")
print("\nCluster assignments saved to: cluster_assignments.txt")Additional Workflow Tips
Memory Management for Large Datasets
def process_large_dataset(sequences, batch_size=32):
"""Process large dataset with memory management."""
import gc
import torch
results = []
for i in range(0, len(sequences), batch_size):
batch = sequences[i:i + batch_size]
# Process batch
batch_results = [process_sequence(seq) for seq in batch]
results.extend(batch_results)
# Clear memory
torch.cuda.empty_cache()
gc.collect()
if (i + batch_size) % 100 == 0:
print(f"Processed {min(i + batch_size, len(sequences))}/{len(sequences)}")
return resultsParallel Processing
from concurrent.futures import ThreadPoolExecutor
import asyncio
def parallel_workflow(sequences, n_workers=4):
"""Process sequences in parallel."""
with ThreadPoolExecutor(max_workers=n_workers) as executor:
results = list(executor.map(process_sequence, sequences))
return resultsThese workflows provide comprehensive examples for common ESM use cases. Adapt them to your specific needs and always validate results with appropriate biological experiments.