Now liveThe Skillselion MCP - thousands of ranked skills, loaded into your agent mid-task. No install.Get it →
eturkes avatar

Glycoengineering

  • 21 installs
  • Updated June 29, 2026
  • eturkes/claude-scientific-skills

Helps with ai & agent building tasks.

About

glycoengineering is a Claude Code skill for ai & agent building. It helps solo builders move faster with AI-assisted coding.

  • glycoengineering
  • AI & Agent Building
  • AI-coding skill

Glycoengineering by the numbers

  • 21 all-time installs (skills.sh)
  • Ranked #10,307 of 16,546 AI & Agent Building skills by installs in the Skillselion catalog
  • Data as of Jul 24, 2026 (Skillselion catalog sync)
npx skills add https://github.com/eturkes/claude-scientific-skills --skill glycoengineering

Add your badge

Show developers this skill is listed on Skillselion. Paste this into your README.

Listed on Skillselion
Installs21
Last updatedJune 29, 2026
Repositoryeturkes/claude-scientific-skills

What it does

Helps with ai & agent building tasks.

Files

SKILL.mdMarkdownGitHub ↗

Glycoengineering

Overview

Glycosylation is the most common and complex post-translational modification (PTM) of proteins, affecting over 50% of all human proteins. Glycans regulate protein folding, stability, immune recognition, receptor interactions, and pharmacokinetics of therapeutic proteins. Glycoengineering involves rational modification of glycosylation patterns for improved therapeutic efficacy, stability, or immune evasion.

Two major glycosylation types:

  • N-glycosylation: Attached to asparagine (N) in the sequon N-X-[S/T] where X ≠ Proline; occurs in the ER/Golgi
  • O-glycosylation: Attached to serine (S) or threonine (T); no strict consensus motif; primarily GalNAc initiation

When to Use This Skill

Use this skill when:

  • Antibody engineering: Optimize Fc glycosylation for enhanced ADCC, CDC, or reduced immunogenicity
  • Therapeutic protein design: Identify glycosylation sites that affect half-life, stability, or immunogenicity
  • Vaccine antigen design: Engineer glycan shields to focus immune responses on conserved epitopes
  • Biosimilar characterization: Compare glycan patterns between reference and biosimilar
  • Drug target analysis: Does glycosylation affect target engagement for a receptor?
  • Protein stability: N-glycans often stabilize proteins; identify sites for stabilizing mutations

N-Glycosylation Sequon Analysis

Scanning for N-Glycosylation Sites

N-glycosylation occurs at the sequon N-X-[S/T] where X ≠ Proline.

import re
from typing import List, Tuple

def find_n_glycosylation_sequons(sequence: str) -> List[dict]:
    """
    Scan a protein sequence for canonical N-linked glycosylation sequons.
    Motif: N-X-[S/T], where X ≠ Proline.

    Args:
        sequence: Single-letter amino acid sequence

    Returns:
        List of dicts with position (1-based), motif, and context
    """
    seq = sequence.upper()
    results = []
    i = 0
    while i <= len(seq) - 3:
        triplet = seq[i:i+3]
        if triplet[0] == 'N' and triplet[1] != 'P' and triplet[2] in {'S', 'T'}:
            context = seq[max(0, i-3):i+6]  # ±3 residue context
            results.append({
                'position': i + 1,   # 1-based
                'motif': triplet,
                'context': context,
                'sequon_type': 'NXS' if triplet[2] == 'S' else 'NXT'
            })
            i += 3
        else:
            i += 1
    return results

def summarize_glycosylation_sites(sequence: str, protein_name: str = "") -> str:
    """Generate a research log summary of N-glycosylation sites."""
    sequons = find_n_glycosylation_sequons(sequence)

    lines = [f"# N-Glycosylation Sequon Analysis: {protein_name or 'Protein'}"]
    lines.append(f"Sequence length: {len(sequence)}")
    lines.append(f"Total N-glycosylation sequons: {len(sequons)}")

    if sequons:
        lines.append(f"\nN-X-S sites: {sum(1 for s in sequons if s['sequon_type'] == 'NXS')}")
        lines.append(f"N-X-T sites: {sum(1 for s in sequons if s['sequon_type'] == 'NXT')}")
        lines.append(f"\nSite details:")
        for s in sequons:
            lines.append(f"  Position {s['position']}: {s['motif']} (context: ...{s['context']}...)")
    else:
        lines.append("No canonical N-glycosylation sequons detected.")

    return "\n".join(lines)

# Example: IgG1 Fc region
fc_sequence = "APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK"
print(summarize_glycosylation_sites(fc_sequence, "IgG1 Fc"))

Mutating N-Glycosylation Sites

def eliminate_glycosite(sequence: str, position: int, replacement: str = "Q") -> str:
    """
    Eliminate an N-glycosylation site by substituting Asn → Gln (conservative).

    Args:
        sequence: Protein sequence
        position: 1-based position of the Asn to mutate
        replacement: Amino acid to substitute (default Q = Gln; similar size, not glycosylated)

    Returns:
        Mutated sequence
    """
    seq = list(sequence.upper())
    idx = position - 1
    assert seq[idx] == 'N', f"Position {position} is '{seq[idx]}', not 'N'"
    seq[idx] = replacement.upper()
    return ''.join(seq)

def add_glycosite(sequence: str, position: int, flanking_context: str = "S") -> str:
    """
    Introduce an N-glycosylation site by mutating a residue to Asn,
    and ensuring X ≠ Pro and +2 = S/T.

    Args:
        position: 1-based position to introduce Asn
        flanking_context: 'S' or 'T' at position+2 (if modification needed)
    """
    seq = list(sequence.upper())
    idx = position - 1

    # Mutate to Asn
    seq[idx] = 'N'

    # Ensure X+1 != Pro (mutate to Ala if needed)
    if idx + 1 < len(seq) and seq[idx + 1] == 'P':
        seq[idx + 1] = 'A'

    # Ensure X+2 = S or T
    if idx + 2 < len(seq) and seq[idx + 2] not in ('S', 'T'):
        seq[idx + 2] = flanking_context

    return ''.join(seq)

O-Glycosylation Analysis

Heuristic O-Glycosylation Hotspot Prediction

def predict_o_glycosylation_hotspots(
    sequence: str,
    window: int = 7,
    min_st_fraction: float = 0.4,
    disallow_proline_next: bool = True
) -> List[dict]:
    """
    Heuristic O-glycosylation hotspot scoring based on local S/T density.
    Not a substitute for NetOGlyc; use as fast baseline.

    Rules:
    - O-GalNAc glycosylation clusters on Ser/Thr-rich segments
    - Flag Ser/Thr residues in windows enriched for S/T
    - Avoid S/T immediately followed by Pro (TP/SP motifs inhibit GalNAc-T)

    Args:
        window: Odd window size for local S/T density
        min_st_fraction: Minimum fraction of S/T in window to flag site
    """
    if window % 2 == 0:
        window = 7
    seq = sequence.upper()
    half = window // 2
    candidates = []

    for i, aa in enumerate(seq):
        if aa not in ('S', 'T'):
            continue
        if disallow_proline_next and i + 1 < len(seq) and seq[i+1] == 'P':
            continue

        start = max(0, i - half)
        end = min(len(seq), i + half + 1)
        segment = seq[start:end]
        st_count = sum(1 for c in segment if c in ('S', 'T'))
        frac = st_count / len(segment)

        if frac >= min_st_fraction:
            candidates.append({
                'position': i + 1,
                'residue': aa,
                'st_fraction': round(frac, 3),
                'window': f"{start+1}-{end}",
                'segment': segment
            })

    return candidates

External Glycoengineering Tools

1. NetOGlyc 4.0 (O-glycosylation prediction)

Web service for high-accuracy O-GalNAc site prediction:

  • URL: https://services.healthtech.dtu.dk/services/NetOGlyc-4.0/
  • Input: FASTA protein sequence
  • Output: Per-residue O-glycosylation probability scores
  • Method: Neural network trained on experimentally verified O-GalNAc sites
import requests

def submit_netoglycv4(fasta_sequence: str) -> str:
    """
    Submit sequence to NetOGlyc 4.0 web service.
    Returns the job URL for result retrieval.

    Note: This uses the DTU Health Tech web service. Results take ~1-5 min.
    """
    url = "https://services.healthtech.dtu.dk/cgi-bin/webface2.cgi"
    # NetOGlyc submission (parameters may vary with web service version)
    # Recommend using the web interface directly for most use cases
    print("Submit sequence at: https://services.healthtech.dtu.dk/services/NetOGlyc-4.0/")
    return url

# Also: NetNGlyc for N-glycosylation prediction
# URL: https://services.healthtech.dtu.dk/services/NetNGlyc-1.0/

2. GlycoShield-MD (Glycan Shielding Analysis)

GlycoShield-MD analyzes how glycans shield protein surfaces during MD simulations:

  • URL: https://gitlab.mpcdf.mpg.de/dioscuri-biophysics/glycoshield-md/
  • Use: Map glycan shielding on protein surface over MD trajectory
  • Output: Per-residue shielding fraction, visualization
# Installation
pip install glycoshield

# Basic usage: analyze glycan shielding from glycosylated protein MD trajectory
glycoshield \
    --topology glycoprotein.pdb \
    --trajectory glycoprotein.xtc \
    --glycan_resnames BGLCNA FUC \
    --output shielding_analysis/

3. GlycoWorkbench (Glycan Structure Drawing/Analysis)

  • URL: https://www.eurocarbdb.org/project/glycoworkbench
  • Use: Draw glycan structures, calculate masses, annotate MS spectra
  • Format: GlycoCT, IUPAC condensed glycan notation

4. GlyConnect (Glycan-Protein Database)

  • URL: https://glyconnect.expasy.org/
  • Use: Find experimentally verified glycoproteins and glycosylation sites
  • Query: By protein (UniProt ID), glycan structure, or tissue
import requests

def query_glyconnect(uniprot_id: str) -> dict:
    """Query GlyConnect for glycosylation data for a protein."""
    url = f"https://glyconnect.expasy.org/api/proteins/uniprot/{uniprot_id}"
    response = requests.get(url, headers={"Accept": "application/json"})
    if response.status_code == 200:
        return response.json()
    return {}

# Example: query EGFR glycosylation
egfr_glyco = query_glyconnect("P00533")

5. UniCarbKB (Glycan Structure Database)

  • URL: https://unicarbkb.org/
  • Use: Browse glycan structures, search by mass or composition
  • Format: GlycoCT or IUPAC notation

Key Glycoengineering Strategies

For Therapeutic Antibodies

GoalStrategyNotes
Enhance ADCCDefucosylation at Fc Asn297Afucosylated IgG1 has ~50× better FcγRIIIa binding
Reduce immunogenicityRemove non-human glycansEliminate α-Gal, NGNA epitopes
Improve PK half-lifeSialylationSialylated glycans extend half-life
Reduce inflammationHypersialylationIVIG anti-inflammatory mechanism
Create glycan shieldAdd N-glycosites to surfaceMasks vulnerable epitopes (vaccine design)

Common Mutations Used

MutationEffect
N297A/Q (IgG1)Removes Fc glycosylation (aglycosyl)
N297D (IgG1)Removes Fc glycosylation
S298A/E333A/K334AIncreases FcγRIIIa binding
F243L (IgG1)Increases defucosylation
T299ARemoves Fc glycosylation

Glycan Notation

IUPAC Condensed Notation (Monosaccharide abbreviations)

SymbolFull NameType
GlcGlucoseHexose
GlcNAcN-AcetylglucosamineHexNAc
ManMannoseHexose
GalGalactoseHexose
FucFucoseDeoxyhexose
Neu5AcN-Acetylneuraminic acid (Sialic acid)Sialic acid
GalNAcN-AcetylgalactosamineHexNAc

Complex N-Glycan Structure

Typical complex biantennary N-glycan:
Neu5Ac-Gal-GlcNAc-Man\
                       Man-GlcNAc-GlcNAc-[Asn]
Neu5Ac-Gal-GlcNAc-Man/
(±Core Fuc at innermost GlcNAc)

Best Practices

  • Start with NetNGlyc/NetOGlyc for computational prediction before experimental validation
  • Verify with mass spectrometry: Glycoproteomics (Byonic, Mascot) for site-specific glycan profiling
  • Consider site context: Not all predicted sequons are actually glycosylated (accessibility, cell type, protein conformation)
  • For antibodies: Fc N297 glycan is critical — always characterize this site first
  • Use GlyConnect to check if your protein of interest has experimentally verified glycosylation data

Additional Resources

  • GlyTouCan (glycan structure repository): https://glytoucan.org/
  • GlyConnect: https://glyconnect.expasy.org/
  • CFG Functional Glycomics: http://www.functionalglycomics.org/
  • DTU Health Tech servers (NetNGlyc, NetOGlyc): https://services.healthtech.dtu.dk/
  • GlycoWorkbench: https://glycoworkbench.software.informer.com/
  • Review: Apweiler R et al. (1999) Biochim Biophys Acta. PMID: 10564035
  • Therapeutic glycoengineering review: Jefferis R (2009) Nature Reviews Drug Discovery. PMID: 19448661

Related skills

This week in AI coding

Five minutes, every Monday - the tools, releases and tactics for developers.

unsubscribe anytime.