
Diffdock
Configure and run DiffDock protein–ligand docking inference batches from CSV inputs and tuned sampling parameters in agent-assisted scientific workflows.
Install
npx skills add https://github.com/k-dense-ai/scientific-agent-skills --skill diffdockWhat is this skill?
- CSV batch format for complex_name, protein_path, ligand_description, and optional protein_sequence rows
- Copy-ready inference YAML with model_dir, confidence_model_dir, and checkpoint filenames
- Tunable inference_steps (default 20) and samples_per_complex (default 10) for accuracy vs cost
- Separate sampling temperatures for translation, rotation, and torsion (temp_sampling_tr/rot/tor)
- Flags for DiffDock-L vs legacy score models (old_score_model, old_filtering_model)
Adoption & trust: 513 installs on skills.sh; 27.6k GitHub stars; 3/3 security scanners passed (skills.sh audits).
Recommended Skills
Journey fit
Structural docking and pose prediction are implemented when you build computational biology backends or offline inference jobs, not during early idea research alone. Backend fits because the skill centers on inference configs, checkpoint paths, and batch CSV formats for running DiffDock/DiffDock-L models.
Common Questions / FAQ
Is Diffdock safe to install?
skills.sh reports 3 of 3 security scanners passed. Review the Security Audits panel on this page before installing in production.
SKILL.md
READMESKILL.md - Diffdock
complex_name,protein_path,ligand_description,protein_sequence example_1,protein1.pdb,CC(=O)Oc1ccccc1C(=O)O, example_2,,COc1ccc(C#N)cc1,MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK example_3,protein3.pdb,ligand3.sdf, # DiffDock Custom Inference Configuration Template # Copy and modify this file to customize inference parameters # Model paths (usually don't need to change these) model_dir: ./workdir/v1.1/score_model confidence_model_dir: ./workdir/v1.1/confidence_model ckpt: best_ema_inference_epoch_model.pt confidence_ckpt: best_model_epoch75.pt # Model version flags old_score_model: false # Set to true to use original DiffDock instead of DiffDock-L old_filtering_model: true # Inference steps inference_steps: 20 # Increase for potentially better accuracy (e.g., 25-30) actual_steps: 19 no_final_step_noise: true # Sampling parameters samples_per_complex: 10 # Increase for difficult cases (e.g., 20-40) sigma_schedule: expbeta initial_noise_std_proportion: 1.46 # Temperature controls - Adjust these to balance exploration vs accuracy # Higher values = more diverse predictions, lower values = more focused predictions # Sampling temperatures temp_sampling_tr: 1.17 # Translation sampling temperature temp_sampling_rot: 2.06 # Rotation sampling temperature temp_sampling_tor: 7.04 # Torsion sampling temperature (increase for flexible ligands) # Psi angle temperatures temp_psi_tr: 0.73 temp_psi_rot: 0.90 temp_psi_tor: 0.59 # Sigma data temperatures temp_sigma_data_tr: 0.93 temp_sigma_data_rot: 0.75 temp_sigma_data_tor: 0.69 # Feature flags no_model: false no_random: false ode: false # Set to true to use ODE solver instead of SDE different_schedules: false limit_failures: 5 # Output settings # save_visualisation: true # Uncomment to save SDF files # ============================================================================ # Configuration Presets for Common Use Cases # ============================================================================ # PRESET 1: High Accuracy (slower, more thorough) # samples_per_complex: 30 # inference_steps: 25 # temp_sampling_tr: 1.0 # temp_sampling_rot: 1.8 # temp_sampling_tor: 6.5 # PRESET 2: Fast Screening (faster, less thorough) # samples_per_complex: 5 # inference_steps: 15 # temp_sampling_tr: 1.3 # temp_sampling_rot: 2.2 # temp_sampling_tor: 7.5 # PRESET 3: Flexible Ligands (more conformational diversity) # samples_per_complex: 20 # inference_steps: 20 # temp_sampling_tr: 1.2 # temp_sampling_rot: 2.1 # temp_sampling_tor: 8.5 # Increased torsion temperature # PRESET 4: Rigid Ligands (more focused predictions) # samples_per_complex: 10 # inference_steps: 20 # temp_sampling_tr: 1.1 # temp_sampling_rot: 2.0 # temp_sampling_tor: 6.0 # Decreased torsion temperature # ============================================================================ # Usage Example # ============================================================================ # python -m inference \ # --config custom_inference_config.yaml \ # --protein_ligand_csv input.csv \ # --out_dir results/ # DiffDock Confidence Scores and Limitations This document provides detailed guidance on interpreting DiffDock confidence scores and understanding the tool's limitations. ## Confidence Score Interpretation DiffDock generates a confidence score for each predicted binding pose. This score indicates the model's certainty about the prediction. ### Score Ranges | Score Range | Confidence Level | Interpretation | |------------|------------------|----------------| | **> 0** | High confidence | Strong prediction, likely accurate binding pose | | **-1.5 to 0** | Moderate confidence | Reasonable prediction, may need validation | | **< -1.5** | Low confidence | Uncertain prediction, requires careful validation | ### Important Notes on